PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna18815.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 314aa    MW: 35430.1 Da    PI: 7.3173
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna18815.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.31.7e-082872345
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                              WT+eE +++ +a +++ ++   +W ++a  ++ g+t  +++  + 
  mrna18815.1-v1.0-hybrid 28 EWTAEENKRFENALALYDKDtpdRWQKVAYLIP-GKTVGDVIKQYK 72
                             5********************************.****99988775 PP

2Myb_DNA-binding46.87e-15139183347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  mrna18815.1-v1.0-hybrid 139 PWTEEEHRQFLMGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 183
                              8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.0882479IPR017884SANT domain
SMARTSM007171.4E-92577IPR001005SANT/Myb domain
CDDcd001674.09E-72874No hitNo description
SuperFamilySSF466892.48E-112881IPR009057Homeodomain-like
PfamPF002498.9E-72872IPR001005SANT/Myb domain
PROSITE profilePS5129420.193132188IPR017930Myb domain
SuperFamilySSF466894.35E-17133187IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-17135187IPR006447Myb domain, plants
SMARTSM007172.8E-13136186IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-13136183IPR009057Homeodomain-like
CDDcd001678.83E-11139183No hitNo description
PfamPF002492.6E-12139183IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MYRGIEVLSP ASYIQNSNWL FQESKGAEWT AEENKRFENA LALYDKDTPD RWQKVAYLIP  60
GKTVGDVIKQ YKELEEDVSD IEAGLIPIPG YSNNNSFTLE WVDDQGFDGL KQYYSVGGNG  120
GKRGSSTRPS EQERKKGVPW TEEEHRQFLM GLKKYGKGDW RNISRNFVTT RTPTQVASHA  180
QKYYIRQLTG GKDKRRSSIH DITTVNVSDT KSGSVGSSQS TTRSSTSQDH ESAVVVQSQQ  240
HPKMSNKQQF DWKVSNEGPQ MVFNSMNGNA IIGPFIGISS PVPKLEEQDF FSGSTFHGSQ  300
FDHHNARFEM QYQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-172691873RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302668.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-108DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM5WJ301e-165M5WJ30_PRUPE; Uncharacterized protein
STRINGPOPTR_0016s11980.11e-147(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-117MYB family protein